What VIP is
VIP (Vasoactive Intestinal Peptide) is a naturally occurring 28-residue neuropeptide with a broad tissue distribution and a well-characterised range of receptor-mediated activities. It has been studied since the 1970s across vascular, gastrointestinal, immunological and neurological research contexts.
Molecular information
- Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
- Number of residues: 28
- Approximate monoisotopic mass: ~3326 Da (as the C-terminal amide)
- Physical form: Typically supplied as a white lyophilised powder
Areas of published research
VIP has been extensively studied in cyclic-AMP signalling, vascular biology, immune modulation and enteric neuroscience. As a 28-residue amidated peptide, analytical work requires reversed-phase HPLC with a well-optimised gradient and LC-MS confirming both the correct mass and the C-terminal amide.
Analytical considerations
Standard research-peptide analytical checks apply: identity confirmation by mass spectrometry (see LC-MS peptide testing explained), purity assessment by reversed-phase HPLC at 214 nm (see what is HPLC peptide testing), and batch-specific documentation (see how to read a peptide COA). Refer to the Peptovia Research Certificate of Analysis page for live examples of the analytical format used for batches supplied.
Further reading
Peer-reviewed literature on VIP is accessible via PubMed and specialist journals. Readers are encouraged to evaluate primary sources directly rather than relying on secondary summaries.
Research Use Only. This profile is an educational overview of VIP as a research peptide. It does not describe or recommend human, veterinary or clinical use. Peptovia Research supplies VIP strictly for in-vitro laboratory research. No dosing, administration or therapeutic guidance is provided or implied.